Lineage for d1kbla2 (1kbl A:377-509)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2850951Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2850952Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 2850953Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)
  7. 2850954Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)
  8. 2850955Domain d1kbla2: 1kbl A:377-509 [68385]
    Other proteins in same PDB: d1kbla1, d1kbla3
    complexed with nh4, so4

Details for d1kbla2

PDB Entry: 1kbl (more details), 1.94 Å

PDB Description: pyruvate phosphate dikinase
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d1kbla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbla2 c.8.1.1 (A:377-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgkiykgd

SCOPe Domain Coordinates for d1kbla2:

Click to download the PDB-style file with coordinates for d1kbla2.
(The format of our PDB-style files is described here.)

Timeline for d1kbla2: