Lineage for d1kbfa_ (1kbf A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707113Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1707114Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 1707115Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 1707122Protein Kinase suppressor of Ras, Ksr [69972] (1 species)
  7. 1707123Species Mouse (Mus musculus) [TaxId:10090] [69973] (2 PDB entries)
  8. 1707125Domain d1kbfa_: 1kbf A: [68381]
    complexed with zn

Details for d1kbfa_

PDB Entry: 1kbf (more details)

PDB Description: solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
PDB Compounds: (A:) Kinase Suppressor of Ras

SCOPe Domain Sequences for d1kbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbfa_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]}
gsvthrfstkswlsqvcnvcqksmifgvkckhcrlkchnkctkeapacr

SCOPe Domain Coordinates for d1kbfa_:

Click to download the PDB-style file with coordinates for d1kbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1kbfa_: