Lineage for d1kbfa_ (1kbf A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 145220Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
  4. 145221Superfamily g.49.1: Cysteine-rich domain [57889] (2 families) (S)
  5. 145222Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (5 proteins)
  6. 145223Protein Kinase suppressor of Ras, Ksr [69972] (1 species)
  7. 145224Species Mouse (Mus musculus) [TaxId:10090] [69973] (2 PDB entries)
  8. 145226Domain d1kbfa_: 1kbf A: [68381]

Details for d1kbfa_

PDB Entry: 1kbf (more details)

PDB Description: solution structure of the cysteine-rich c1 domain of kinase suppressor of ras

SCOP Domain Sequences for d1kbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbfa_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus)}
gsvthrfstkswlsqvcnvcqksmifgvkckhcrlkchnkctkeapacr

SCOP Domain Coordinates for d1kbfa_:

Click to download the PDB-style file with coordinates for d1kbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1kbfa_: