Lineage for d1kbea1 (1kbe A:331-378)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264294Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2264295Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2264296Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2264303Protein Kinase suppressor of Ras, Ksr [69972] (1 species)
  7. 2264304Species Mouse (Mus musculus) [TaxId:10090] [69973] (2 PDB entries)
  8. 2264305Domain d1kbea1: 1kbe A:331-378 [68380]
    Other proteins in same PDB: d1kbea2
    complexed with zn

Details for d1kbea1

PDB Entry: 1kbe (more details)

PDB Description: Solution structure of the cysteine-rich C1 domain of Kinase Suppressor of Ras
PDB Compounds: (A:) Kinase Suppressor of Ras

SCOPe Domain Sequences for d1kbea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbea1 g.49.1.1 (A:331-378) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]}
svthrfstkswlsqvcnvcqksmifgvkckhcrlkchnkctkeapacr

SCOPe Domain Coordinates for d1kbea1:

Click to download the PDB-style file with coordinates for d1kbea1.
(The format of our PDB-style files is described here.)

Timeline for d1kbea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbea2