Lineage for d1kbea1 (1kbe A:331-378)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037803Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 3037810Protein Kinase suppressor of Ras, Ksr [69972] (1 species)
  7. 3037811Species Mouse (Mus musculus) [TaxId:10090] [69973] (2 PDB entries)
  8. 3037812Domain d1kbea1: 1kbe A:331-378 [68380]
    Other proteins in same PDB: d1kbea2
    complexed with zn

Details for d1kbea1

PDB Entry: 1kbe (more details)

PDB Description: solution structure of the cysteine-rich c1 domain of kinase suppressor of ras
PDB Compounds: (A:) Kinase Suppressor of Ras

SCOPe Domain Sequences for d1kbea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbea1 g.49.1.1 (A:331-378) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]}
svthrfstkswlsqvcnvcqksmifgvkckhcrlkchnkctkeapacr

SCOPe Domain Coordinates for d1kbea1:

Click to download the PDB-style file with coordinates for d1kbea1.
(The format of our PDB-style files is described here.)

Timeline for d1kbea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbea2