Lineage for d1kb0a2 (1kb0 A:1-573)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066614Protein Quinoprotein alcohol dehydrogenase, N-terminal domain [69326] (2 species)
    fused with the C-terminal cytochrome c domain
  7. 2066615Species Comamonas testosteroni [TaxId:285] [69327] (1 PDB entry)
  8. 2066616Domain d1kb0a2: 1kb0 A:1-573 [68379]
    Other proteins in same PDB: d1kb0a1
    complexed with ca, gol, hec, pqq, tfb

Details for d1kb0a2

PDB Entry: 1kb0 (more details), 1.44 Å

PDB Description: Crystal Structure of Quinohemoprotein Alcohol Dehydrogenase from Comamonas testosteroni
PDB Compounds: (A:) quinohemoprotein alcohol dehydrogenase

SCOPe Domain Sequences for d1kb0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}
tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws
ynlestrgveatpvvvdgimyvsaswsvvhaidtrtgnriwtydpqidrstgfkgccdvv
nrgvalwkgkvyvgawdgrlialdaatgkevwhqntfegqkgsltitgaprvfkgkviig
nggaeygvrgyitaydaetgerkwrwfsvpgdpskpfedesmkraartwdpsgkwweagg
ggtmwdsmtfdaelntmyvgtgngspwshkvrspkggdnlylasivaldpdtgkykwhyq
etpgdnwdytstqpmiladikiagkprkvilhapkngfffvldrtngkfisaknfvpvnw
asgydkhgkpigiaaardgskpqdavpgpygahnwhpmsfnpqtglvylpaqnvpvnlmd
dkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrllawdpvaqkaawsvehvspwn
ggtlttagnvvfqgtadgrlvayhaatgeklweaptgtgvvaapstymvdgrqyvsvavg
wggvyglaaraterqgpgtvytfvvggkarmpe

SCOPe Domain Coordinates for d1kb0a2:

Click to download the PDB-style file with coordinates for d1kb0a2.
(The format of our PDB-style files is described here.)

Timeline for d1kb0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kb0a1