Lineage for d1ka7a_ (1ka7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965623Protein The Xlp protein Sap [55591] (1 species)
  7. 2965624Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries)
  8. 2965634Domain d1ka7a_: 1ka7 A: [68371]
    complex with peptide

Details for d1ka7a_

PDB Entry: 1ka7 (more details)

PDB Description: sap/sh2d1a bound to peptide n-y-c
PDB Compounds: (A:) sh2 domain protein 1a

SCOPe Domain Sequences for d1ka7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka7a_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvekkss

SCOPe Domain Coordinates for d1ka7a_:

Click to download the PDB-style file with coordinates for d1ka7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ka7a_: