Lineage for d1ka1a_ (1ka1 A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339094Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 339095Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families) (S)
  5. 339096Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)
  6. 339097Protein 3';5'-adenosine bisphosphatase, PAP phosphatase [56669] (2 species)
  7. 339098Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69878] (4 PDB entries)
  8. 339099Domain d1ka1a_: 1ka1 A: [68369]
    complexed with a3p, bme, ca, mg

Details for d1ka1a_

PDB Entry: 1ka1 (more details), 1.3 Å

PDB Description: The PAPase Hal2p complexed with calcium and magnesium ions and reaction substrate: PAP

SCOP Domain Sequences for d1ka1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
alerellvatqavrkaslltkriqsevishkdsttitkndnspvttgdyaaqtiiinaik
snfpddkvvgeesssglsdafvsgilneikandevynknykkddflftndqfplksledv
rqiidfgnyeggrkgrfwcldpidgtkgflrgeqfavclalivdgvvqlgcigcpnlvls
sygaqdlkghesfgyifravrglgafyspssdaeswtkihvrhlkdtkdmitlegvekgh
sshdeqtaiknklniskslhldsqakycllalgladvylrlpiklsyqekiwdhaagnvi
vheaggihtdamedvpldfgngrtlatkgviassgprelhdlvvstscdviqsr

SCOP Domain Coordinates for d1ka1a_:

Click to download the PDB-style file with coordinates for d1ka1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ka1a_: