SCOP 1.67: Domain d1k9oe_: 1k9o E:

Lineage for d1k9oe_ (1k9o E:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries)

8. Domain d1k9oe_: 1k9o E: [68355]
   Other proteins in same PDB: d1k9oi_
   Michaelis serpin-trypsin complex
   mutant

Details for d1k9oe_

PDB Entry: 1k9o, 2.3 Å

PDB Description: crystal structure of michaelis serpin-trypsin complex

SCOP Domain Sequences for d1k9oe_:

Sequence; same for both SEQRES and ATOM records:

>d1k9oe_ b.47.1.2 (E:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1k9oe_:

• d1k9oe_ first appeared in SCOP 1.59
  
• d1k9oe_ appears in SCOP 1.65
  
• d1k9oe_ appears in SCOP 1.69
  
• d1k9oe_ appears in the current release, SCOPe 2.08