Lineage for d1k9oe_ (1k9o E:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) Protein Trypsin(ogen) [50515] (7 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (25 PDB entries) 
Domain d1k9oe_: 1k9o E: [68355]
Other proteins in same PDB: d1k9oi_
Details for d1k9oe_
PDB Entry: 1k9o (more details), 2.3 Å
PDB Description: crystal structure of michaelis serpin-trypsin complex
SCOP Domain Sequences for d1k9oe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9oe_ b.47.1.2 (E:) Trypsin(ogen) {Rat (Rattus norvegicus)}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
SCOP Domain Coordinates for d1k9oe_:
Click to download the PDB-style file with coordinates for d1k9oe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k9oe_:
- d1k9oe_ first appeared in SCOP 1.59
- d1k9oe_ appears in SCOP 1.63
- d1k9oe_ appears in the current release, SCOPe 2.08
View in 3D
