Lineage for d1k9jb_ (1k9j B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)
    Uniprot Q9NNX6 219-397
  8. 2234678Domain d1k9jb_: 1k9j B: [68354]
    complexed with ca

Details for d1k9jb_

PDB Entry: 1k9j (more details), 1.9 Å

PDB Description: Complex of DC-SIGNR and GlcNAc2Man3
PDB Compounds: (B:) mDC-SIGN2 TYPE I ISOFORM

SCOPe Domain Sequences for d1k9jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9jb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
hcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfs
wmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdny
wickkpaa

SCOPe Domain Coordinates for d1k9jb_:

Click to download the PDB-style file with coordinates for d1k9jb_.
(The format of our PDB-style files is described here.)

Timeline for d1k9jb_: