![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (5 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (17 proteins) |
![]() | Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69858] (1 PDB entry) |
![]() | Domain d1k9jb_: 1k9j B: [68354] |
PDB Entry: 1k9j (more details), 1.9 Å
SCOP Domain Sequences for d1k9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9jb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)} hcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfs wmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdny wickkpaa
Timeline for d1k9jb_: