SCOP 1.67: Domain d1k9ij_: 1k9i J:

Lineage for d1k9ij_ (1k9i J:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69856] (1 PDB entry)

8. Domain d1k9ij_: 1k9i J: [68352]
   complexed with ca, man, nag

Details for d1k9ij_

PDB Entry: 1k9i, 2.5 Å

PDB Description: complex of dc-sign and glcnac2man3

SCOP Domain Sequences for d1k9ij_:

Sequence; same for both SEQRES and ATOM records:

>d1k9ij_ d.169.1.1 (J:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens)}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaa

Timeline for d1k9ij_:

• d1k9ij_ first appeared in SCOP 1.59
  
• d1k9ij_ appears in SCOP 1.65
  
• d1k9ij_ appears in SCOP 1.69
  
• d1k9ij_ appears in the current release, SCOPe 2.08