![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69856] (7 PDB entries) Uniprot Q9NNX6 253-384 |
![]() | Domain d1k9ih_: 1k9i H: [68350] complexed with ca |
PDB Entry: 1k9i (more details), 2.5 Å
SCOPe Domain Sequences for d1k9ih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9ih_ d.169.1.1 (H:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]} pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf wickksa
Timeline for d1k9ih_: