SCOP 1.71: Domain d1k9ic_: 1k9i C:

Lineage for d1k9ic_ (1k9i C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69856] (3 PDB entries)

8. Domain d1k9ic_: 1k9i C: [68345]

Details for d1k9ic_

PDB Entry: 1k9i, 2.5 Å

PDB Description: complex of dc-sign and glcnac2man3

SCOP Domain Sequences for d1k9ic_:

Sequence; same for both SEQRES and ATOM records:

>d1k9ic_ d.169.1.1 (C:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens)}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaa

Timeline for d1k9ic_:

• d1k9ic_ first appeared in SCOP 1.59
  
• d1k9ic_ appears in SCOP 1.69
  
• d1k9ic_ appears in SCOP 1.73
  
• d1k9ic_ appears in the current release, SCOPe 2.08