SCOPe 2.07: Domain d1k9ba_: 1k9b A:

Lineage for d1k9ba_ (1k9b A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Soybean (Glycine max) [TaxId:3847] [57251] (5 PDB entries)

8. Domain d1k9ba_: 1k9b A: [68342]

Details for d1k9ba_

PDB Entry: 1k9b, 2.8 Å

PDB Description: Crystal structure of the bifunctional soybean Bowman-Birk inhibitor at 0.28 nm resolution. Structural peculiarities in a folded protein conformation

PDB Compounds: (A:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d1k9ba_:

Sequence; same for both SEQRES and ATOM records:

>d1k9ba_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]}
kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck

Timeline for d1k9ba_:

• d1k9ba_ first appeared in SCOP 1.59
  
• d1k9ba_ appears in SCOPe 2.06
  
• d1k9ba_ appears in the current release, SCOPe 2.08