SCOP 1.63: Domain d1k99a_: 1k99 A:

Lineage for d1k99a_ (1k99 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (1 family)

5. Family a.21.1.1: HMG-box [47096] (9 proteins)

6. Protein Upstream binding factor [68982] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68983] (3 PDB entries)

8. Domain d1k99a_: 1k99 A: [68341]
   HMG box 1

Details for d1k99a_

PDB Entry: 1k99

PDB Description: solution structure of the first hmg box in human upstream binding factor

SCOP Domain Sequences for d1k99a_:

Sequence; same for both SEQRES and ATOM records:

>d1k99a_ a.21.1.1 (A:) Upstream binding factor {Human (Homo sapiens)}
mkklkkhpdfpkkpltpyfrffmekrakyaklhpemsnldltkilskkykelpekkkmky
iqdfqrekqefernlarfredhpdliqnakk

Timeline for d1k99a_:

• d1k99a_ first appeared in SCOP 1.59
  
• d1k99a_ appears in SCOP 1.61
  
• d1k99a_ appears in SCOP 1.65
  
• d1k99a_ appears in the current release, SCOPe 2.08, called d1k99a1