Lineage for d1k99a_ (1k99 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96008Fold a.21: HMG-box [47094] (1 superfamily)
  4. 96009Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 96010Family a.21.1.1: HMG-box [47096] (8 proteins)
  6. 96046Protein Upstream binding factor, the first HMG box [68982] (1 species)
  7. 96047Species Human (Homo sapiens) [TaxId:9606] [68983] (1 PDB entry)
  8. 96048Domain d1k99a_: 1k99 A: [68341]

Details for d1k99a_

PDB Entry: 1k99 (more details)

PDB Description: Solution Structure of the first HMG box in human Upstream binding factor

SCOP Domain Sequences for d1k99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k99a_ a.21.1.1 (A:) Upstream binding factor, the first HMG box {Human (Homo sapiens)}
mkklkkhpdfpkkpltpyfrffmekrakyaklhpemsnldltkilskkykelpekkkmky
iqdfqrekqefernlarfredhpdliqnakk

SCOP Domain Coordinates for d1k99a_:

Click to download the PDB-style file with coordinates for d1k99a_.
(The format of our PDB-style files is described here.)

Timeline for d1k99a_: