Lineage for d1k98a2 (1k98 A:741-900)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102924Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2102925Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 protein domains)
  6. 2102942Protein Methionine synthase, C-terminal domain [52244] (1 species)
  7. 2102943Species Escherichia coli [TaxId:562] [52245] (5 PDB entries)
  8. 2102949Domain d1k98a2: 1k98 A:741-900 [68339]
    Other proteins in same PDB: d1k98a1, d1k98a3
    complexed with b12, so4

Details for d1k98a2

PDB Entry: 1k98 (more details), 3.75 Å

PDB Description: AdoMet complex of MetH C-terminal fragment
PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1k98a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k98a2 c.23.6.1 (A:741-900) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]}
eqgktngkmviatvkgdvgdigknivgvvlqcnnyeivdlgvmvpaekilrtakevnadl
iglsglitpsldemvnvakemerqgftiplliggattskahtavkieqnysgptvyvqna
srtvgvvaallsdtqrddfvartrkeyetvriqhgrkkpr

SCOPe Domain Coordinates for d1k98a2:

Click to download the PDB-style file with coordinates for d1k98a2.
(The format of our PDB-style files is described here.)

Timeline for d1k98a2: