SCOPe 2.05: Domain d1k98a1: 1k98 A:651-740

Lineage for d1k98a1 (1k98 A:651-740)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.1: Methionine synthase domain [47644] (1 family)
   automatically mapped to Pfam PF02607

5. Family a.46.1.1: Methionine synthase domain [47645] (1 protein)

6. Protein Methionine synthase domain [47646] (1 species)

7. Species Escherichia coli [TaxId:562] [47647] (5 PDB entries)

8. Domain d1k98a1: 1k98 A:651-740 [68338]
   Other proteins in same PDB: d1k98a2, d1k98a3
   complexed with b12, so4

Details for d1k98a1

PDB Entry: 1k98, 3.75 Å

PDB Description: adomet complex of meth c-terminal fragment

PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1k98a1:

Sequence; same for both SEQRES and ATOM records:

>d1k98a1 a.46.1.1 (A:651-740) Methionine synthase domain {Escherichia coli [TaxId: 562]}
qaewrswevnkrleyslvkgitefieqdteearqqatrpieviegplmdgmnvvgdlfge
gkmflpqvvksarvmkqavaylepfieask

Timeline for d1k98a1:

• d1k98a1 first appeared in SCOP 1.59
  
• d1k98a1 appears in SCOPe 2.04
  
• d1k98a1 appears in SCOPe 2.06
  
• d1k98a1 appears in the current release, SCOPe 2.08