Lineage for d1k95a_ (1k95 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490593Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1490642Protein Grancalcin [47550] (1 species)
    Calpain small subunit homologue
  7. 1490643Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 1490646Domain d1k95a_: 1k95 A: [68335]

Details for d1k95a_

PDB Entry: 1k95 (more details), 1.9 Å

PDB Description: crystal structure of des(1-52)grancalcin with bound calcium
PDB Compounds: (A:) grancalcin

SCOPe Domain Sequences for d1k95a_:

Sequence, based on SEQRES records: (download)

>d1k95a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai

Sequence, based on observed residues (ATOM records): (download)

>d1k95a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavaevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfnafke
lwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngriffd
dyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai

SCOPe Domain Coordinates for d1k95a_:

Click to download the PDB-style file with coordinates for d1k95a_.
(The format of our PDB-style files is described here.)

Timeline for d1k95a_: