| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
| Protein Grancalcin [47550] (1 species) Calpain small subunit homologue |
| Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries) |
| Domain d1k94b_: 1k94 B: [68334] complexed with ca |
PDB Entry: 1k94 (more details), 1.7 Å
SCOPe Domain Sequences for d1k94b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k94b_ a.39.1.8 (B:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai
Timeline for d1k94b_: