Lineage for d1k94a_ (1k94 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1734551Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1734607Protein Grancalcin [47550] (1 species)
    Calpain small subunit homologue
  7. 1734608Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 1734609Domain d1k94a_: 1k94 A: [68333]
    complexed with ca

Details for d1k94a_

PDB Entry: 1k94 (more details), 1.7 Å

PDB Description: Crystal structure of des(1-52)grancalcin with bound calcium
PDB Compounds: (A:) grancalcin

SCOPe Domain Sequences for d1k94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai

SCOPe Domain Coordinates for d1k94a_:

Click to download the PDB-style file with coordinates for d1k94a_.
(The format of our PDB-style files is described here.)

Timeline for d1k94a_: