Lineage for d1k8wa2 (1k8w A:74-312)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) 
Superfamily d.58.35: Pseudouridine synthase [55120] (2 families) 
Family d.58.35.2: Pseudouridine synthase II TruB [69746] (1 protein) Protein Pseudouridine synthase II TruB [69747] (1 species) Species Escherichia coli [TaxId:562] [69748] (1 PDB entry) 
Domain d1k8wa2: 1k8w A:74-312 [68318]
Details for d1k8wa2
PDB Entry: 1k8w (more details), 1.85 Å
PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA
SCOP Domain Sequences for d1k8wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8wa2 d.58.35.2 (A:74-312) Pseudouridine synthase II TruB {Escherichia coli}
kryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysalkyqg
kklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlgeklgc
gahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspasdypv
vnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvvey
SCOP Domain Coordinates for d1k8wa2:
Click to download the PDB-style file with coordinates for d1k8wa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k8wa2:
- d1k8wa2 is new in SCOP 1.59
- d1k8wa2 appears in SCOP 1.61
- d1k8wa2 last appears in SCOP 1.63
View in 3D
