SCOP 1.63: Domain d1k8wa1: 1k8w A:9-73

Lineage for d1k8wa1 (1k8w A:9-73)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.35: Pseudouridine synthase [55120] (3 families)
   duplication: contains two subdomains of this fold

5. Family d.58.35.2: Pseudouridine synthase II TruB [69746] (1 protein)
   contains additional C-terminal alpha+beta domain

6. Protein Pseudouridine synthase II TruB [69747] (1 species)

7. Species Escherichia coli [TaxId:562] [69748] (1 PDB entry)

8. Domain d1k8wa1: 1k8w A:9-73 [68317]

Details for d1k8wa1

PDB Entry: 1k8w, 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA

SCOP Domain Sequences for d1k8wa1:

Sequence; same for both SEQRES and ATOM records:

>d1k8wa1 d.58.35.2 (A:9-73) Pseudouridine synthase II TruB {Escherichia coli}
mdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsqy
lldsd

Timeline for d1k8wa1:

• d1k8wa1 first appeared in SCOP 1.59
  
• d1k8wa1 appears in SCOP 1.61
  
• d1k8wa1 last appears in SCOP 1.65