Lineage for d1k8wa1 (1k8w A:9-73)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 134274Superfamily d.58.35: Pseudouridine synthase [55120] (2 families) (S)
  5. 134282Family d.58.35.2: Pseudouridine synthase II TruB [69746] (1 protein)
  6. 134283Protein Pseudouridine synthase II TruB [69747] (1 species)
  7. 134284Species Escherichia coli [TaxId:562] [69748] (1 PDB entry)
  8. 134285Domain d1k8wa1: 1k8w A:9-73 [68317]

Details for d1k8wa1

PDB Entry: 1k8w (more details), 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA

SCOP Domain Sequences for d1k8wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8wa1 d.58.35.2 (A:9-73) Pseudouridine synthase II TruB {Escherichia coli}
mdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsqy
lldsd

SCOP Domain Coordinates for d1k8wa1:

Click to download the PDB-style file with coordinates for d1k8wa1.
(The format of our PDB-style files is described here.)

Timeline for d1k8wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8wa2