SCOPe 2.05: Domain d1k8oa_: 1k8o A:

Lineage for d1k8oa_ (1k8o A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase [69365] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69366] (2 PDB entries)

8. Domain d1k8oa_: 1k8o A: [68315]

Details for d1k8oa_

PDB Entry: 1k8o

PDB Description: solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase

PDB Compounds: (A:) E2 component of Branched-Chain ahpha-Ketoacid Dehydrogenase

SCOPe Domain Sequences for d1k8oa_:

Sequence; same for both SEQRES and ATOM records:

>d1k8oa_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
mgqvvqfklsdigegirevtvkewyvkegdtvsqfdsicevqsdkasvtitsrydgvikk
lyynlddiayvgkplvdietealkdle

Timeline for d1k8oa_:

• d1k8oa_ first appeared in SCOP 1.59
  
• d1k8oa_ appears in SCOPe 2.04
  
• d1k8oa_ is called d1k8oa1 in SCOPe 2.06
  
• d1k8oa_ appears in the current release, SCOPe 2.08, called d1k8oa1