Lineage for d1k8ma1 (1k8m A:2-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817438Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2817439Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2817480Protein Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase [69365] (1 species)
  7. 2817481Species Human (Homo sapiens) [TaxId:9606] [69366] (2 PDB entries)
  8. 2817482Domain d1k8ma1: 1k8m A:2-85 [68314]
    Other proteins in same PDB: d1k8ma2, d1k8ma3

Details for d1k8ma1

PDB Entry: 1k8m (more details)

PDB Description: solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
PDB Compounds: (A:) E2 component of Branched-Chain ahpha-Ketoacid Dehydrogenase

SCOPe Domain Sequences for d1k8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ma1 b.84.1.1 (A:2-85) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gqvvqfklsdigegirevtvkewyvkegdtvsqfdsicevqsdkasvtitsrydgvikkl
yynlddiayvgkplvdietealkd

SCOPe Domain Coordinates for d1k8ma1:

Click to download the PDB-style file with coordinates for d1k8ma1.
(The format of our PDB-style files is described here.)

Timeline for d1k8ma1: