Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase [69365] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69366] (2 PDB entries) |
Domain d1k8ma1: 1k8m A:2-85 [68314] Other proteins in same PDB: d1k8ma2, d1k8ma3 |
PDB Entry: 1k8m (more details)
SCOPe Domain Sequences for d1k8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ma1 b.84.1.1 (A:2-85) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} gqvvqfklsdigegirevtvkewyvkegdtvsqfdsicevqsdkasvtitsrydgvikkl yynlddiayvgkplvdietealkd
Timeline for d1k8ma1: