SCOP 1.69: Domain d1k8kf_: 1k8k F:

Lineage for d1k8kf_ (1k8k F:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)

6. Protein ARPC4 (20 kDa subunit) [69647] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69648] (1 PDB entry)

8. Domain d1k8kf_: 1k8k F: [68312]
   Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kg_

Details for d1k8kf_

PDB Entry: 1k8k, 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex

SCOP Domain Sequences for d1k8kf_:

Sequence; same for both SEQRES and ATOM records:

>d1k8kf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus)}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

Timeline for d1k8kf_:

• d1k8kf_ first appeared in SCOP 1.59
  
• d1k8kf_ appears in SCOP 1.67
  
• d1k8kf_ appears in SCOP 1.71
  
• d1k8kf_ appears in the current release, SCOPe 2.08