Class a: All alpha proteins [46456] (289 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries) Uniprot O15145 # 100% sequence identity |
Domain d1k8ke_: 1k8k E: [68311] Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8kf_, d1k8kg_ |
PDB Entry: 1k8k (more details), 2 Å
SCOPe Domain Sequences for d1k8ke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ke_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d1k8ke_: