Lineage for d1k8ke_ (1k8k E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650091Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 650092Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
  5. 650093Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein)
  6. 650094Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 650095Species Cow (Bos taurus) [TaxId:9913] [69063] (10 PDB entries)
  8. 650096Domain d1k8ke_: 1k8k E: [68311]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8kf_, d1k8kg_

Details for d1k8ke_

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex
PDB Compounds: (E:) arp2/3 complex 21 kda subunit

SCOP Domain Sequences for d1k8ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ke_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

SCOP Domain Coordinates for d1k8ke_:

Click to download the PDB-style file with coordinates for d1k8ke_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ke_: