Lineage for d1k8kd1 (1k8k D:1-120)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422531Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 422577Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 422578Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 422579Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 422580Species Cow (Bos taurus) [TaxId:9913] [69650] (1 PDB entry)
  8. 422581Domain d1k8kd1: 1k8k D:1-120 [68309]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8ke_, d1k8kf_, d1k8kg_

Details for d1k8kd1

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex

SCOP Domain Sequences for d1k8kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8kd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus)}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOP Domain Coordinates for d1k8kd1:

Click to download the PDB-style file with coordinates for d1k8kd1.
(The format of our PDB-style files is described here.)

Timeline for d1k8kd1: