Lineage for d1k8kd1 (1k8k D:1-120)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199664Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
  4. 199704Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 199705Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 199706Protein ARPC2 (34 kDa subunit) [69649] (1 species)
  7. 199707Species Cow (Bos taurus) [TaxId:9913] [69650] (1 PDB entry)
  8. 199708Domain d1k8kd1: 1k8k D:1-120 [68309]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8ke_, d1k8kf_, d1k8kg_

Details for d1k8kd1

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex

SCOP Domain Sequences for d1k8kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8kd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus)}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOP Domain Coordinates for d1k8kd1:

Click to download the PDB-style file with coordinates for d1k8kd1.
(The format of our PDB-style files is described here.)

Timeline for d1k8kd1: