Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin-related protein 2, Arp2 [69530] (1 species) part of Arp2/3 complex |
Species Cow (Bos taurus) [TaxId:9913] [69531] (1 PDB entry) |
Domain d1k8kb1: 1k8k B:154-343 [68307] Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_, d1k8kg_ the second half only |
PDB Entry: 1k8k (more details), 2 Å
SCOP Domain Sequences for d1k8kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus)} gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd veklskfkir
Timeline for d1k8kb1: