Lineage for d1k8ka2 (1k8k A:161-418)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316626Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 316687Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 316688Species Cow (Bos taurus) [TaxId:9913] [69529] (1 PDB entry)
  8. 316690Domain d1k8ka2: 1k8k A:161-418 [68306]
    Other proteins in same PDB: d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_, d1k8kg_

Details for d1k8ka2

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex

SCOP Domain Sequences for d1k8ka2:

Sequence, based on SEQRES records: (download)

>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus)}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy
eeigpsicrhnpvfgvms

Sequence, based on observed residues (ATOM records): (download)

>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus)}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelskpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeig
psicrhnpvfgvms

SCOP Domain Coordinates for d1k8ka2:

Click to download the PDB-style file with coordinates for d1k8ka2.
(The format of our PDB-style files is described here.)

Timeline for d1k8ka2: