Lineage for d1k8ib2 (1k8i B:1-94)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021417Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1021489Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88831] (1 PDB entry)
  8. 1021490Domain d1k8ib2: 1k8i B:1-94 [68304]
    Other proteins in same PDB: d1k8ia1, d1k8ia2, d1k8ib1
    complexed with nag

Details for d1k8ib2

PDB Entry: 1k8i (more details), 3.1 Å

PDB Description: crystal structure of mouse h2-dm
PDB Compounds: (B:) MHC class II H2-M beta 2 chain

SCOPe Domain Sequences for d1k8ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ib2 d.19.1.1 (B:1-94) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]}
gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni
lneqeslihrlqnglqdcathtqpfwdvlthrtr

SCOPe Domain Coordinates for d1k8ib2:

Click to download the PDB-style file with coordinates for d1k8ib2.
(The format of our PDB-style files is described here.)

Timeline for d1k8ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8ib1