Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88627] (1 PDB entry) probably orthologous to the human HLA-DM |
Domain d1k8ib1: 1k8i B:95-190 [68303] Other proteins in same PDB: d1k8ia1, d1k8ia2, d1k8ib2 complexed with nag |
PDB Entry: 1k8i (more details), 3.1 Å
SCOPe Domain Sequences for d1k8ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ib1 b.1.1.2 (B:95-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]} apsvrvaqttpfntrepvmlacyvwgfypadvtitwmkngqlvpshsnkektaqpngdwt yqtvsylaltpsygdvytcvvqhsgtsepirgdwtp
Timeline for d1k8ib1: