Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88818] (1 PDB entry) |
Domain d1k8ia2: 1k8i A:11-92 [68302] Other proteins in same PDB: d1k8ia1, d1k8ib1, d1k8ib2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1k8i (more details), 3.1 Å
SCOPe Domain Sequences for d1k8ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ia2 d.19.1.1 (A:11-92) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]} qnhtfrhtlfcqdgipniglsetydedelfsfdfsqntrvprlpdfaewaqgqgdasaia fdksfcemlmrevspklegqip
Timeline for d1k8ia2: