Lineage for d1k8ia2 (1k8i A:11-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938295Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88818] (1 PDB entry)
  8. 2938296Domain d1k8ia2: 1k8i A:11-92 [68302]
    Other proteins in same PDB: d1k8ia1, d1k8ib1, d1k8ib2
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1k8ia2

PDB Entry: 1k8i (more details), 3.1 Å

PDB Description: crystal structure of mouse h2-dm
PDB Compounds: (A:) MHC class II H2-M alpha chain

SCOPe Domain Sequences for d1k8ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ia2 d.19.1.1 (A:11-92) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]}
qnhtfrhtlfcqdgipniglsetydedelfsfdfsqntrvprlpdfaewaqgqgdasaia
fdksfcemlmrevspklegqip

SCOPe Domain Coordinates for d1k8ia2:

Click to download the PDB-style file with coordinates for d1k8ia2.
(The format of our PDB-style files is described here.)

Timeline for d1k8ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8ia1