Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88620] (1 PDB entry) probably orthologous to the human HLA-DM |
Domain d1k8ia1: 1k8i A:93-191 [68301] Other proteins in same PDB: d1k8ia2, d1k8ib1, d1k8ib2 complexed with nag |
PDB Entry: 1k8i (more details), 3.1 Å
SCOPe Domain Sequences for d1k8ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ia1 b.1.1.2 (A:93-191) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]} vsrglpvaevftlkplefgkpntlvcfisnlfpptltvnwqlhsapvegasptsisavdg ltfqafsylnftpepfdlysctvtheidrytaiaywvpq
Timeline for d1k8ia1: