Lineage for d1k8ia1 (1k8i A:93-191)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747414Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88620] (1 PDB entry)
    probably orthologous to the human HLA-DM
  8. 2747415Domain d1k8ia1: 1k8i A:93-191 [68301]
    Other proteins in same PDB: d1k8ia2, d1k8ib1, d1k8ib2
    complexed with nag

Details for d1k8ia1

PDB Entry: 1k8i (more details), 3.1 Å

PDB Description: crystal structure of mouse h2-dm
PDB Compounds: (A:) MHC class II H2-M alpha chain

SCOPe Domain Sequences for d1k8ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ia1 b.1.1.2 (A:93-191) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]}
vsrglpvaevftlkplefgkpntlvcfisnlfpptltvnwqlhsapvegasptsisavdg
ltfqafsylnftpepfdlysctvtheidrytaiaywvpq

SCOPe Domain Coordinates for d1k8ia1:

Click to download the PDB-style file with coordinates for d1k8ia1.
(The format of our PDB-style files is described here.)

Timeline for d1k8ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8ia2