Lineage for d1k8gc2 (1k8g C:205-316)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110612Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 110651Protein Telomere end binding protein alpha subunit [50273] (1 species)
  7. 110652Species Oxytricha nova [TaxId:200597] [50274] (4 PDB entries)
  8. 110664Domain d1k8gc2: 1k8g C:205-316 [68300]

Details for d1k8gc2

PDB Entry: 1k8g (more details), 2.6 Å

PDB Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA

SCOP Domain Sequences for d1k8gc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8gc2 b.40.4.3 (C:205-316) Telomere end binding protein alpha subunit {Oxytricha nova}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqdd

SCOP Domain Coordinates for d1k8gc2:

Click to download the PDB-style file with coordinates for d1k8gc2.
(The format of our PDB-style files is described here.)

Timeline for d1k8gc2: