SCOP 1.59: Domain d1k8gc2: 1k8g C:205-316

Lineage for d1k8gc2 (1k8g C:205-316)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)

7. Species Oxytricha nova [TaxId:200597] [50274] (4 PDB entries)

8. Domain d1k8gc2: 1k8g C:205-316 [68300]

Details for d1k8gc2

PDB Entry: 1k8g, 2.6 Å

PDB Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA

SCOP Domain Sequences for d1k8gc2:

Sequence; same for both SEQRES and ATOM records:

>d1k8gc2 b.40.4.3 (C:205-316) Telomere end binding protein alpha subunit {Oxytricha nova}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqdd

Timeline for d1k8gc2:

• d1k8gc2 is new in SCOP 1.59
  
• d1k8gc2 appears in SCOP 1.61
  
• d1k8gc2 appears in the current release, SCOPe 2.07