Lineage for d1k8gc1 (1k8g C:36-204)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166823Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (7 proteins)
  6. 166871Protein Telomere end binding protein alpha subunit [50273] (1 species)
  7. 166872Species Oxytricha nova [TaxId:200597] [50274] (4 PDB entries)
  8. 166883Domain d1k8gc1: 1k8g C:36-204 [68299]

Details for d1k8gc1

PDB Entry: 1k8g (more details), 2.6 Å

PDB Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA

SCOP Domain Sequences for d1k8gc1:

Sequence, based on SEQRES records: (download)

>d1k8gc1 b.40.4.3 (C:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

Sequence, based on observed residues (ATOM records): (download)

>d1k8gc1 b.40.4.3 (C:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgasdya
tlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtq
einnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

SCOP Domain Coordinates for d1k8gc1:

Click to download the PDB-style file with coordinates for d1k8gc1.
(The format of our PDB-style files is described here.)

Timeline for d1k8gc1: