Class b: All beta proteins [48724] (126 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (9 proteins) barrel, closed; n=5, S=10 |
Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries) |
Domain d1k8gb2: 1k8g B:205-316 [68298] |
PDB Entry: 1k8g (more details), 2.6 Å
SCOP Domain Sequences for d1k8gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8gb2 b.40.4.3 (B:205-316) Telomere end binding protein alpha subunit {Oxytricha nova} vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqdd
Timeline for d1k8gb2:
View in 3D Domains from other chains: (mouse over for more information) d1k8ga1, d1k8ga2, d1k8gc1, d1k8gc2 |