Lineage for d1k8da2 (1k8d A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856721Species Mouse (Mus musculus), IB QA-2 [TaxId:10090] [69680] (1 PDB entry)
  8. 856722Domain d1k8da2: 1k8d A:1-181 [68293]
    Other proteins in same PDB: d1k8da1, d1k8db_

Details for d1k8da2

PDB Entry: 1k8d (more details), 2.3 Å

PDB Description: crystal structure of the non-classical MHC class Ib Qa-2 complexed with a self peptide
PDB Compounds: (A:) QA-2 antigen

SCOP Domain Sequences for d1k8da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8da2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), IB QA-2 [TaxId: 10090]}
gqhslqyfhtavsrpglgepwfisvgyvddtqfvrfdsdaenprmeprarwmeqegpeyw
eretqiakgheqsfrgslrtaqsyynqskggshtlqwmygcdmgsdgrllrgylqfayeg
rdyialnedlktwtavdmaaqitrrkweqagiaekdqaylegtcmqslrrylelgketll
r

SCOP Domain Coordinates for d1k8da2:

Click to download the PDB-style file with coordinates for d1k8da2.
(The format of our PDB-style files is described here.)

Timeline for d1k8da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8da1
View in 3D
Domains from other chains:
(mouse over for more information)
d1k8db_