Lineage for d1k83k_ (1k83 K:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134642Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 134714Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
  5. 134731Family d.74.3.2: RPB11 [64311] (1 protein)
  6. 134732Protein RPB11 [64312] (1 species)
  7. 134733Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (4 PDB entries)
  8. 134735Domain d1k83k_: 1k83 K: [68286]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83l_

Details for d1k83k_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83k_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d1k83k_:

Click to download the PDB-style file with coordinates for d1k83k_.
(The format of our PDB-style files is described here.)

Timeline for d1k83k_: