Lineage for d1k83i2 (1k83 I:50-122)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 145106Superfamily g.41.9: Zn-binding RNA polymerase subunits [63393] (2 families) (S)
  5. 145107Family g.41.9.1: RBP9 subunit of RNA polymerase II [63394] (1 protein)
  6. 145108Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
  7. 145111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)
  8. 145115Domain d1k83i2: 1k83 I:50-122 [68284]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83j_, d1k83k_, d1k83l_

Details for d1k83i2

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83i2 g.41.9.1 (I:50-122) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqfs

SCOP Domain Coordinates for d1k83i2:

Click to download the PDB-style file with coordinates for d1k83i2.
(The format of our PDB-style files is described here.)

Timeline for d1k83i2: