SCOP 1.65: Domain d1k83i1: 1k83 I:1-49

Lineage for d1k83i1 (1k83 I:1-49)

Root: SCOP 1.65
Class g: Small proteins [56992] (66 folds)
Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families)
Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins)
Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
contains two differently decorated domains of this fold
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)
Domain d1k83i1: 1k83 I:1-49 [68283]
Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83j_, d1k83k_, d1k83l_

Details for d1k83i1

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83i1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d1k83i1:

Click to download the PDB-style file with coordinates for d1k83i1.
(The format of our PDB-style files is described here.)

Timeline for d1k83i1: