Lineage for d1k83f_ (1k83 F:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330715Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 330716Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
  5. 330730Family d.78.1.2: RPB6 [55294] (1 protein)
  6. 330731Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 330732Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (4 PDB entries)
  8. 330734Domain d1k83f_: 1k83 F: [68281]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    complexed with ilx, mn, trx, zn

Details for d1k83f_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83f_ d.78.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae)}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d1k83f_:

Click to download the PDB-style file with coordinates for d1k83f_.
(The format of our PDB-style files is described here.)

Timeline for d1k83f_: