SCOPe 2.02: Domain d1k83e2: 1k83 E:144-215

Lineage for d1k83e2 (1k83 E:144-215)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family)

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d1k83e2: 1k83 E:144-215 [68280]
   Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
   protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83e2

PDB Entry: 1k83, 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

PDB Compounds: (E:) DNA-directed RNA polymerase II 27kd polypeptide

SCOPe Domain Sequences for d1k83e2:

Sequence; same for both SEQRES and ATOM records:

>d1k83e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d1k83e2:

• d1k83e2 first appeared in SCOP 1.59
  
• d1k83e2 appears in SCOPe 2.01
  
• d1k83e2 appears in SCOPe 2.03
  
• d1k83e2 appears in the current release, SCOPe 2.08