Lineage for d1k83e2 (1k83 E:144-215)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330715Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 330716Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
  5. 330717Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 330718Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 330719Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (5 PDB entries)
  8. 330722Domain d1k83e2: 1k83 E:144-215 [68280]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    complexed with ilx, mn, trx, zn

Details for d1k83e2

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d1k83e2:

Click to download the PDB-style file with coordinates for d1k83e2.
(The format of our PDB-style files is described here.)

Timeline for d1k83e2: