Lineage for d1k83e1 (1k83 E:3-143)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1171025Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 1171026Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 1171027Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 1171028Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1171032Domain d1k83e1: 1k83 E:3-143 [68279]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83e1

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
PDB Compounds: (E:) DNA-directed RNA polymerase II 27kd polypeptide

SCOPe Domain Sequences for d1k83e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83e1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa
npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk
lvpsippatietfneaalvvn

SCOPe Domain Coordinates for d1k83e1:

Click to download the PDB-style file with coordinates for d1k83e1.
(The format of our PDB-style files is described here.)

Timeline for d1k83e1: